PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227161.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YB
Protein Properties Length: 270aa    MW: 29266.5 Da    PI: 5.7359
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227161.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB160.62.4e-5082176195
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqd+++Pianv+rim+++lP +akis+daket+qecvse+i+f+t+ea+++cqre+rkt++++d+lwa+++lGf++yvepl+++l+k+re e+
  XP_008227161.2  82 VREQDQYMPIANVIRIMRRILPPHAKISDDAKETIQECVSEYIAFITGEANERCQREQRKTVTAEDILWAMGKLGFDNYVEPLTLFLQKHRESEN 176
                     69******************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.0E-4878181IPR009072Histone-fold
SuperFamilySSF471138.38E-3685181IPR009072Histone-fold
PfamPF008083.9E-2588152IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.8E-16116134No hitNo description
PRINTSPR006153.8E-16135153No hitNo description
PRINTSPR006153.8E-16154172No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MTNMESSEFR KYAPSNQNQD LEKGNSGKLT HRPVTPAQVN NSERSNSKAP INATPAATNS  60
NAAAAVANAG DPAQLTPQQS VVREQDQYMP IANVIRIMRR ILPPHAKISD DAKETIQECV  120
SEYIAFITGE ANERCQREQR KTVTAEDILW AMGKLGFDNY VEPLTLFLQK HRESENSDRS  180
TLRAEFMKRD RAVDFGSAGP PIALMPPPPP YGPGYPFGPQ HGPGMFDPSM LGMFRDGSSS  240
GSGGGAGSSS ASGDQGQNSL EGFDPFAQFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-3983173393NF-YB
4awl_B1e-3983173494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3983173494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214722.11e-112hypothetical protein PRUPE_ppa026173mg, partial
TrEMBLM5WRR41e-112M5WRR4_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-59NF-YB family protein